PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_2AC682D6D.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 249aa    MW: 27611.7 Da    PI: 6.376
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_2AC682D6D.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.32.1e-10104161562
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62 
                            kr +r   NR +A rs +R+  +i+eLe kv+ L++e ++L  +l +l+  ++ l ++
  Traes_1AL_2AC682D6D.1 104 KRVKRVLANRQSAARSKERRMRYIAELEHKVQILQTEATTLSAQLTHLQRDSSGLATH 161
                            999*********************************************9888776655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-15100164IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.542102165IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.09E-11104154No hitNo description
Gene3DG3DSA:1.20.5.1703.5E-11104158No hitNo description
PfamPF001701.4E-9104159IPR004827Basic-leucine zipper domain
CDDcd147033.05E-19105154No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 249 aa     Download sequence    Send to blast
MPPANGADSS ENESEDYSGV ESQVFLWGEA GRKRNAAGEP AAAATRHARS LSMDSLMGKL  60
SFSANGGEPS KFSLEFGSGE FTPAEMKRIM ADEKLAEMAL ADPKRVKRVL ANRQSAARSK  120
ERRMRYIAEL EHKVQILQTE ATTLSAQLTH LQRDSSGLAT HNNELKFRLQ AMEQQAQLRD  180
ALNEALTGEV QRLKQSATSE RGGDAGSSSN LAQQMQLRCQ NQMLEMHKQQ QQQIPFYQLE  240
QPEQNGESN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3668260.0AK366826.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2047D05.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574243.21e-141PREDICTED: transcription factor RF2b-like
SwissprotQ69IL47e-49RF2A_ORYSJ; Transcription factor RF2a
TrEMBLW4ZMV70.0W4ZMV7_WHEAT; Uncharacterized protein
STRINGMLOC_66865.11e-162(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.34e-73bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]